BLASTX 1.4.9-Paracel [2002-09-03] 

Query= BeAS1498
         (696 letters)

Database: go/blasto/sptr 
           812,717 sequences; 278,041,132 total letters

Graphical Overview:

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q86SZ2 Human full-length cDNA clone CS0DK012YE11 of HeLa cells o...   129     2e-29
Q86U35 Human full-length cDNA clone CS0DM009YC24 of fetal liver ...    88     9e-17
Q99394 Transport protein particle 33 kDa subunit GO:0006810 GO:0...    67     1e-10

>Q86SZ2 Human full-length cDNA clone CS0DK012YE11 of HeLa cells of
           Homo sapiens GO:0046821
          Length = 158

 Score =  129 bits (325), Expect = 2e-29
 Identities = 68/158 (43%), Positives = 92/158 (58%), Gaps = 1/158 (0%)
 Frame = +1

Query: 145 VAEPALHFMLM-EMVHTLEASTPHASGDREAVYFKLEMLGYNVGQRLVERMAKDHARFKD 321
           +A+ AL  +L  EMV  +  S      +      KLE +G+ VGQ L+ER  KD ARFKD
Sbjct: 1   MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKD 60

Query: 322 TLDVVKFICKDFWTALFRKQVDNLKTNHRGVYVLQDNNFRWFTNASSAGSPQDTTRAMTP 501
            LD++KFICKDFWT +F+KQ+DNL+TNH+G+YVLQDN FR  T  S+    +      + 
Sbjct: 61  ELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAG---KQYLEHASK 117

Query: 502 YLWFPCXXXXXXXXXXXXPTVVMAESAGLPQCTFQIKI 615
           YL F C             ++V AE + +P C FQ+ I
Sbjct: 118 YLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMI 155


>Q86U35 Human full-length cDNA clone CS0DM009YC24 of fetal liver of
           Homo sapiens GO:0046821
          Length = 94

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 41/94 (43%), Positives = 56/94 (58%)
 Frame = +1

Query: 334 VKFICKDFWTALFRKQVDNLKTNHRGVYVLQDNNFRWFTNASSAGSPQDTTRAMTPYLWF 513
           +KFICKDFWT +F+KQ+DNL+TNH+G+YVLQDN FR  T  S+    +      + YL F
Sbjct: 1   MKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAG---KQYLEHASKYLAF 57

Query: 514 PCXXXXXXXXXXXXPTVVMAESAGLPQCTFQIKI 615
            C             ++V AE + +P C FQ+ I
Sbjct: 58  TCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMI 91


>Q99394 Transport protein particle 33 kDa subunit GO:0006810
           GO:0005794 GO:0030008 GO:0006888 GO:0005783
          Length = 268

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 36/104 (34%), Positives = 60/104 (57%), Gaps = 6/104 (5%)
 Frame = +1

Query: 223 DREAVYFKLEMLGYNVGQRLVERMA---KDHARFK--DTLDVVKFICKDFWTALFRKQVD 387
           ++E V  +L  +G+ +G +L E +      + +FK  D L ++KFIC+D W  +F KQ+D
Sbjct: 115 EKEKVLARLRNIGFQIGLKLSELLIFSNNPNLKFKEMDLLLIMKFICRDVWKQIFGKQID 174

Query: 388 NLKTNHRGVYVLQDNNFRWFTNAS-SAGSPQDTTRAMTPYLWFP 516
           NLKTNHRG + L D ++R   + S    +  +  + + P+L  P
Sbjct: 175 NLKTNHRGTFYLLDYDYRPIQSFSLEEDAKNEELKMIEPFLEIP 218


  Database: go/blasto/sptr
    Posted date:  Mar 6, 2004  4:23 AM
  Number of letters in database: 278,041,132
  Number of sequences in database:  812,717
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
length of database: 278,041,132
effective HSP length: 116
effective length of database: 183,765,960
effective search space used: 21133085400
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)